>it's a private corporation
>they can do what they want
It's a private corporation
Other urls found in this thread:
gohmert.house.gov
youtube.com
youtube.com
bitchute.com
breitbart.com
moneyandmarkets.com
reclaimthenet.org
washingtontimes.com
dailywire.com
townhall.com
theepochtimes.com
pjmedia.com
en.wikipedia.org
en.wikipedia.org
en.wikipedia.org
cambridgeblog.org
newsweek.com
twitter.com
Google isn't doing anything that The New York Times hasn't done before. It's just out in the open now.
Can we all agree that lolbergs have been utterly BTFO by the massive increase of shit like this recently?
>b...bbut we don't live in a REAL free market guise, it'll be way better once they have even more power and less oversight, we promise!
Come home White men.
But they need to take responsibility for the shit they do. They make editorial decisions, like say blatant FEC violations, they pay the consequences.
>corporations never do anything wrong
libetarians, lol
>that nose
Every. Single. Time.
A private corporation protected by platform laws, using public infrastructure and receiving government grants*.
I seriously hope a whole bunch of Nasims rise up. And I hope they can actually aim instead of the original Nasim.
>Google isn't doing anything that The New York Times hasn't done before
A congressman recently put forward a proposal to treat Google as a publisher like the Jew York Times.
This means they would be subject to lawsuits like libel (which makes sense if they are using editorial edit rather than acting as a platform).
I love how they flipflop and suddenly become libertarians and free market champions when it suits them.
Is there a specific term for it?
Hypocritical feels like it's too nonspecific.
And publicly traded. Publicly traded corporations don't get to be the political toys of their executives...
Sure. Google is a private editor. They can do whatever they want. Inside the law that is.
your faggot graph is a graph for faggots
Exactly this, I fucking hate it too.
People who hide behind "but the free market!" and then try and do shit like this or use government power to protect themselves are the vermin of the planet. Koch brothers also do this.
They are doing the same, but are not treated the same. That's exactly where the problem lies.
make sure this shit hits the normiesphere and lets get this bitch to testify before fucking congress
It's infuriating because they have no real principals, so they feel no shame in abandoning their position anytime it suits them.
It really reminds me of
>Whenever you tried to attack one of these apostles, your hand closed on a jelly-like slime which divided up and poured through your fingers, but in the next moment collected again.
this guy gets it.
the new york times can be sued for libel while big tech has government immunity
pilpul satanist jews
THIS IS AN ATTACK ON THE FREE PRESS!
It's okay for google to remove a video that selectively edits things to twist people's words around. They're just digging for dirt on big tech because they're jealous.
lolberts BTFO. Now we just gotta get the Trump administration in charge of Google to halt progressive corporatism :-)
Jewish works quite well.
Google is a massive fucking service weaved into every aspect of modern life. How is this a fucking comparison? They are Youtube. They are Google. They are most email. They are a fucking giant.
I bet there's a word in German for that.
The nyt also gets the rope - and so do lolbergs
no they can't
If legality dictates morality then I don't want to hear another complaint when I call a nigger a nigger to their face.
The word you are looking for is "Jewish".
Das Juden
>lol, uploading anti-YouTube video on YouTube
Conservatives really are all about independence/individualism, right? But at least now you know that you got their attention.
Beauty dictates morality fundamentally - but the violence you can bring to bear dictates it practically
Conservatives need to become Fascists if they want to win
google and amazon keep fucking up like this they're gonna get broken the fuck up just like microshaft.
TREAD LIGHTLY GOOGLE
An archived link to keep it alive
gohmert.house.gov
Obviously government needs to step in to splinter Google.
>hating Google
>you need to be removed
she looks like a rat too
Why should a private corporation not have a preference in political issues in a modern liberal democracy? I honestly can't see how a modern liberal democratic system could say there's something wrong with what Google is doing.
Surprisingly, twitter is better for free speech
As long as you don't do hate speech
Fine. Be biased. But, be open about it with your consumers or expect a backlash when it's proven.
We should classify Google as a publisher, same as NYT
And we should also break them up with antitrust
And the executives and upper-middle management should all be fined / go to jail
The problem with USA is that their politicians are all corrupt and all received money like Google, so they really can't say shit. They dug their own grave, it's called capitalism. There's really nothing moral in capitalism.
Sieschlagenumundwerdenplötzlichzulibertärenundchampionsdesfreienmarkteswennesihnenpasstheit.
how about we take the fluoride out of the water supply before we start trying to push towards forced taxation and less freedom of speech under a fascist rule. eh?
The most illegal thing with Google is them paying cash and making money, since if they do that then they should abide by country's laws, which they don't. Internet isn't regulated by laws, since we talking here about a company spanning multiple countries, which on itself is illegal if it is anything else than public room. When they added cash and business to those sites they fucked up internet.
Corporations are not people, they should not have any kind of influence or control in our economic or political system, particularly because they will influence the economic and political system in their favor, which pointedly, is not in the favor of the people.
The government exists to serve the interests of the PEOPLE. Not corporations, not the government.
THE PEOPLE.
This is the single biggest problem with all modern western governments today. They've forgotten they're looking out for the people, and now it's just a morass of corruption, I got mine fuck you, and sure mr goldberg we'll look the other way while you hire illegals and dump pollutants into the waterways.
They can have their own preference, but actively trying to subvert the democratic process is a whole other ball game.
What's the problem? The lady said they wanted to prevent the 2016 situation meaning preventing foreign influence with troll arms like Russia.
Unless it enhances greenhouse gasses, employs gender deniers, snatches folks from the jaws of welfare....
who has the balls to make a youtube video about this?
"Do no evil". Anyone remember that? What a fucking joke.
She’s quite the looker.
They are a private corporation and they should have the right to moderate their content as they see fit, just like on Jow Forums
We need to update the laws to keep them from being held liable for content while still allowing them to promote their values in the content provided by the community.
Honestly, it's 2019. When were these platforms founded? They're just a bit behind the curve with the laws because of the speed of the advancement of technology and culture.
HELLO GOOGLE/FBI
ALL LOLBERGS REPORT TO THE SHOWERS
That's true, that a private company can remove anybody they want, problem is they are also a profit company.
Profit company: when you make any kind of money, hand out any kind of money on top of established site. Google is input and output, so not final public site.
Non-profit company: you settled/bought all equipment, put out a site, it only is public, doesn't discusses finances any longer, it is only output.
If government takes taxes and established a public company, then makes money, that's corruption. Money should be spend to create the site/company, not further make money.
Google isn't a public platform, it's a private profit company.
Can a company like Google really be called a simple private corporation when they have pretty much a monopoly (name one actual competitor of Google), they receive massive amounts of money from the government and hold a ton of government contracts, and one could consider them a public space or domain. This prohibits them from censoring peoples freedom of speech since pretty much a majority of people and I'm talking 98% to 99% of people on the internet use their services to express ideas, make videos, the list goes on.
Welcome to free market capitalism
First you need to understand that American capitalists totally ignored founding fathers and disguised private companies as public companies. There being stocks anybody can invest into isn't a public company, by no stretch of imagination, but Americans call that public company. It's total corruption. A public company should serve the public through taxes that are equal, not somebody investing more to have more power and people having no say and public company not working for people.
I'm no shill. I'm dead serious. You can't support jannies and mods on sites that claim total free speech. That's not free speech.
Look at Jow Forums. There are sets of rules that guide what is acceptable behavior.
That being said, get rid of all mods on all sites if it suits you. I don't know if the result will be as good as you think.
How do we determine what's oppressive to the users? Well, I say what a private business says, goes (within reason). Make another site if you don't like the way someone runs theirs.
However, holding that business liable for what a user has posted is not right. We have free speech, but we are responsible for what comes out of our mouths.
youtube.com
youtube.com
bitchute.com
breitbart.com
>Google Censors Video Exposing Google
moneyandmarkets.com
>Project Veritas Uncovers Google Plot to Stop the ‘Next Trump Situation’
reclaimthenet.org
>video reveals how Google’s biased AI isn’t a conspiracy theory
washingtontimes.com
>Google executive was caught on hidden camera declaring that the federal government should not break up the tech giant — because then it would be more difficult to prevent “the next Trump situation.”
dailywire.com
>Whistleblower: Here’s How Google Functions As A ‘Highly Biased Political Machine’
townhall.com
>Google Executive: Breaking Up Google Will Make It Harder 'To Prevent The Next Trump Situation'
theepochtimes.com
>Google Stealthily Infuses Political Agenda Into Products to Prevent Trump Reelection
pjmedia.com
>Project Veritas Reveals Google's 'Fairness' Efforts to Prevent 2016 From Happening Again
We need National Socialism
The nose chico, it never lies.
THIS ISN'T A FREE MARKET YOU FUCKING RETARD
But a Jew could never be parted from his opinions.
At that time I was still childish enough to try to make the madness of their doctrine clear to them; in my little circle I talked my tongue sore and my throat hoarse, thinking I would inevitably succeed in convincing them how ruinous their Marxist madness was; but what I accomplished was often the opposite. It seemed as though their increased understanding of the destructive effects of Social Democratic theories and their results only reinforced their determination.
The more I argued with them, the better I came to know their dialectic. First they counted on the stupidity of their adversary, and then, when there was no other way out, they themselves simply played stupid. If all this didn't help, they pretended not to understand, or, if challenged, they changed the subject in a hurry, quoted platitudes which, if you accepted them, they immediately related to entirely different matters, and then, if again attacked, gave ground and pretended not to know exactly what you were talking about. Whenever you tried to attack one of these apostles, your hand closed on a jelly-like slime which divided up and poured through your fingers, but in the next moment collected again. But if you really struck one of these fellows so telling a blow that, observed by the audience, he couldn't help but agree, and if you believed that this had taken you at least one step forward, your amazement was great the next day. The Jew had not the slightest recollection of the day before, he rattled off his same old nonsense as though nothing at all had happened, and, if indignantly challenged, affected amazement; he couldn't remember a thing, except that he had proved the correctness of his assertions the previous day.
Sometimes I stood there thunderstruck.
I didn't know what to be more amazed at: the agility of their tongues or their virtuosity at lying.
Never actually happened, that was just an excuse the democrats used to cover for their illegal spying and explain away Trump winning.
If you bought it, you fell for their scam.
The most telling part was when they described things that the "russians" did, but it was actually things that regular joes on Jow Forums or facebook had done.
They are only doing what's legal to make their candidate more likely to win. That's exactly what I do every time before elections. I don't see any difference there except in scale.
I can't see how foreign influence could be anything wrong in a modern liberal democracy (as long as they influence by legal means, of course).
This is what free markets inevitably become without oversight - capital is used to capture the government (or create one) in order to restrict the ability of other entities to compete.
If the people do not control the economy, the economy will control the people
Google claims to be a public space (like an ancient Roman forum) and is treated as such by the government.
Google is NOT a private company. Google got its seed money from the venture capital firm In-Q-Tel which is a CIA front company. This means it was American tax dollars that started the company and they became extremely rich off of our money. This is also why when they had to restructure they called their parent company Alphabet Inc. It has always been a military project (along with Facebook which was Lifelog and Twitter etc) gathering data on all our searches, transactions, emails, etc which is being stored in facilities like the one in Utah and being compiled and analyzed by AI. Humans BUILT Google, YouTube, Facebook, as well as the AI through blockchain. Now they plan to use it to program the population, thinking the AI knows enough about humans, to be able to predict and shape our behavior (and it's working on a large segment of the population hence the clown world).
ok honestly tho I’m still gonna use google/youtube etc. it’s just organized and stuff this small bump will affect it for some time but people will honestly just forget it and you know to yourself this will pass
I wouldn't call what's going on free market capitalism per se. Even in a free market capitalism it is still the governments job to make sure that corporations cannot form monopolies in the economy.
Once the government starts looking the other way, a more accurate description of what's going on would be either mercantilism or just open crony capitalism.
IT HASN'T BEEN A FREE MARKET IN OVER 100 YEARS YOU ABSOLUTE FUCKING MORON
kek
wrong
they have TOS, which have to be applied consitently.
>that makes it ok
ERRRRRRRRRR wrong answer Hans.
That's how modern liberal democracy works. People vote for the government to do stuff they want. If they don't want that, they should vote someone else. Your proposition sounds reasonable to me but it doesn't mean that Google is doing anything wrong in the context of a modern liberal democracy.
don't forget that the CIA and other three letter agencies have long been infiltrated by fags and radical trannies
Thanks to all that mercury you will not remember anything that tasted so good
muh private company meme was never meant to characterize america without the implicit protestant ethic. decadence has taken them.
imagine being so insecure and weak minded that you change political position that much, just because of some shitposts on Jow Forums
USA was a closed country 100 years ago, not free market.
en.wikipedia.org
>William McKinley Jr.
>was the 25th president of the United States
>assassination
>During his presidency, McKinley led the nation to victory in the Spanish–American War
>promote American industry and kept the nation on the gold standard
en.wikipedia.org
>The Presidency of Theodore Roosevelt on September 14, 1901, when Theodore Roosevelt became the 26th President of the United States upon the assassination and death of President William McKinley
>Roosevelt faced the greatest domestic economic crisis since the Panic of 1893. The U.S. stock market entered a slump in early 1907
>which created the National Monetary Commission to study the nation's banking system; the commission's recommendations would later form the basis of the Federal Reserve System.
Private banking took control of federal government:
en.wikipedia.org
>A financial crisis known as the Panic of 1907 was headed off by a private conglomerate (led by J. P. Morgan), who set themselves up as "lenders of last resort" to banks in trouble
cambridgeblog.org
>With an authorized strength of only 3,820 officers and 84,799 men, the volunteer US Army consequently did not possess either the manpower or the modern weaponry to conduct a campaign in Europe, much less against a great power such as Germany, when the United States entered the war in April 1917.
Teddy Roosevelt and Woodrow Wilson had a vision of globalist USA with non-stop war and debt, unlike predecessor presidents.
>Google Censors Google
Can we get it trending?
She's a troll type kike.
this is her response
she does nothing to address the video, she just calls it conspiracy theories
i wonder what it would take to get Google to react to the video officially
Free markets dont exist unless the people closely oversee them - the natural tendency of unrrstricted competition is for the winners to seize control of the governing apparatus and use it to prevent anyone from competeing with them
>#Google-doesnt-check-itself
Oh vey! Google censoring again!
newsweek.com
>I have never gone public with my concerns, until now. The writing of this article was triggered by a notification from YouTube this week, that my eight-minute video, The Holocaust - A Short History, was flagged as "Age Restricted." According to YouTube, "Age-Restricted videos are not visible to users who are logged out, or under 18 years of age, or have 'Restricted Mode' enabled."
>It contains a clip from captured German archival films of the actual mass killings of Jews by the Einsatzgruppen death squads.
Jewish
I think youtube should be free to be a lefty shill site and right wingers should just start their own platform. Your telling me between the 50 various or so right wing e celebs they cant start a shared platform? Especially if you got the gamers to go as well even the fucking commies if you have too. They straight just shill late night stuff anyways
Tries to spin it like it's all in service of fighting against the Russian bogeyman.
BAKE THAT CAKE
>dude just make your own platformpaymentprocessorserverhostbankshippingservice lmao
>i travel therefore i am important
That meany you are a loser who steals everywhere and can't settle down.